WDR4 Rabbit Polyclonal Antibody TA346004 from OriGene Technologies | Biocompare.com

Supplier Images

WDR4 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
WDR4 Rabbit Polyclonal Antibody

The WDR4 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to WDR4. This antibody recognizes Human antigen. The WDR4 Rabbit Polyclonal Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-WDR4 Antibody

Product Specs
ItemWDR4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA346004
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetWDR4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4. Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
NCBI Full Gene NameWD repeat domain 4
NCBI Gene AliasesWuho, GAMOS6, hWH, TRM82, MIGSB, TRMT82
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!